DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and Plppr2

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001277228.1 Gene:Plppr2 / 235044 MGIID:2384575 Length:452 Species:Mus musculus


Alignment Length:265 Identity:74/265 - (27%)
Similarity:109/265 - (41%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTFKRGFFCSDLSIRYPY--KDCTITVPMLLLMMLLL--PMLFVAVVEIMR------------- 48
            :||  :||||.|.:...||  .:.....|..|:..|:.  |.|.:.:.|:.|             
Mouse    44 VHT--QGFFCYDSAYAKPYPGPEAASRAPPALIYALVTAGPTLTILLGELARAFFPAPPSSSPVS 106

  Fly    49 --------ICKRFRTRLYFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPR---L 102
                    .|.||...|  |.|.|....:|||...|.:.....:...|...|||...|:|.   |
Mouse   107 GESTIVSGACCRFSPPL--RRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTAL 169

  Fly   103 DDGSSCSDLQNAELYV-EQFHCTNNNLSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHGVWRGR 166
            .......|....:.:| :|..|..   |...:.....:||...::|..|::...|:||..|:|.:
Mouse   170 GCPPPSPDRPGPDRFVTDQSACAG---SPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVK 231

  Fly   167 GGVRVLRHVLQFLLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQTSST 231
            |. |:::..|...||..|..|.:.|||:|.:||||||||.|.|...|......|.:..:.:..|.
Mouse   232 GS-RLVKPSLCLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPHSG 295

  Fly   232 GRIPP 236
            .|:.|
Mouse   296 RRLSP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 49/158 (31%)
Plppr2NP_001277228.1 PAP2_wunen 125..281 CDD:239479 49/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834732
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.