DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and plpr-1

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_496399.1 Gene:plpr-1 / 174710 WormBaseID:WBGene00011524 Length:396 Species:Caenorhabditis elegans


Alignment Length:229 Identity:56/229 - (24%)
Similarity:103/229 - (44%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RGFFCSDLSIRYPY---KDCTITV--PMLLLMMLLLPMLFVAVVEIM---------RI----CKR 52
            |.|:|.|:.:..|.   :|..:.|  |:|..:...:|.|.:.:.|:|         :|    |..
 Worm    69 RVFYCRDVHLYKPNFVPEDFNVYVSYPLLYTLAFTIPPLVILIGEVMFWLFSTKPRKIVYANCGE 133

  Fly    53 FRTRLYFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSC-SDLQNAEL 116
            ....|:.|.|:|....:..|.:...:..:..|...|..||:|...|...:   ::| :.|:::..
 Worm   134 CPVHLFTRRLFRFVIIYLAGLLIVQIFVDTIKLMTGYQRPYFLSLCNVSI---TACTAPLEHSPS 195

  Fly   117 YVEQFHCTNNNLSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHGVWRGRGGVRVLRHVLQFLLL 181
            ......|  |.....::|...::|||.|:.:|.|:....:||::.:...| |..:||.:|.|..:
 Worm   196 PSPHLAC--NYRGADELRYAWLTFPSLHAVVSSYAACFASLYIYYMINLR-GAPLLRPLLIFGFM 257

  Fly   182 MAALCV--SLSRVADYWHHWSDVLAGALLGVTYA 213
              .||:  |.||:..|.:||.|:....::|:..|
 Worm   258 --GLCIVDSFSRINGYKNHWRDIWVAWVIGIFMA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 39/155 (25%)
plpr-1NP_496399.1 PAP2_wunen 142..293 CDD:239479 39/156 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.