DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and plpp4

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_002937854.2 Gene:plpp4 / 100487728 XenbaseID:XB-GENE-6051164 Length:271 Species:Xenopus tropicalis


Alignment Length:235 Identity:69/235 - (29%)
Similarity:98/235 - (41%) Gaps:48/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YKDCTI---TVPMLLLMML--LLPMLFVAVVEIMRICKRFRTRLYFRNLWRAEATFSFGFIATYL 78
            ||:..:   .:|..|:..:  |.|:..:.||:|  |.:..||.:.     .|....|.......:
 Frog    39 YKNPLVQSDNIPTRLMFAISFLTPLAVIFVVKI--ILRTDRTEVK-----EACLAVSLALALNGV 96

  Fly    79 TTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNNLSTRQIRELHVSFPSA 143
            .|...|..|||.||.||:.|.|   ||.|          .|:.|||.:   ...:.|...||||.
 Frog    97 CTNTIKLIVGRPRPDFFYRCFP---DGVS----------NEEMHCTGD---ASLVSEGRKSFPSI 145

  Fly   144 HSSLSFYSMVLLALYVHGVWR-----GRGGVRVLRHVLQFLLLMAALCVSLSRVADYWHHWSDVL 203
            |||.:|..:...:.|:.|...     |:|  :..|.....|.|..|:.::|||:.||.|||.|..
 Frog   146 HSSFAFAGLGFTSFYLAGKLHCFTELGQG--KSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSF 208

  Fly   204 AGALLGVTYAAITAAYVGNLLRRQTSSTGRIPPSLNYSHH 243
            .|.::|     :..||   |..||     ..||..:.|.|
 Frog   209 VGGVIG-----LILAY---LCYRQ-----HYPPLTHLSCH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 48/159 (30%)
plpp4XP_002937854.2 PAP2_containing_1_like 37..225 CDD:239484 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.