DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and sgpp2

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001373215.1 Gene:sgpp2 / 100330698 ZFINID:ZDB-GENE-120221-2 Length:415 Species:Danio rerio


Alignment Length:103 Identity:26/103 - (25%)
Similarity:43/103 - (41%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LQFLLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQTSS-----TGRI- 234
            |...:||:.| |.|||:....|...||:.|..:.....|::..|.|.:...|..:     .|.: 
Zfish   205 LAVAVLMSVL-VCLSRLYTGMHSALDVICGVAISAFIIAVSYPYWGTIDYLQLHNPVAPVVGMVL 268

  Fly   235 PPSLNYSHHLHHQLMADNNNSTASAKVHFLAAAASASM 272
            |..|.|::.     ..|:.::|.......||.:|..|:
Zfish   269 PLFLAYTYP-----ELDHYSTTRGDTTIILACSAGCSV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 13/40 (33%)
sgpp2NP_001373215.1 PAP2_SPPase1 96..243 CDD:239482 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.