DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and plpp5

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001121478.1 Gene:plpp5 / 100158576 XenbaseID:XB-GENE-5812193 Length:266 Species:Xenopus tropicalis


Alignment Length:229 Identity:68/229 - (29%)
Similarity:95/229 - (41%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTFKRGFFCSDLSI-RYPY--KDCTITVPMLLLMMLLLPMLFVAVVEIMRICKRFRTRLYFRNL 62
            ||.|:|.....::.: |.||  .|...|..|.|: ..|.|:|.|.:..:               .
 Frog    29 MHPFERLIQPEEMWLYRNPYVVSDRVPTNSMFLI-SFLTPLLVVVLARV---------------F 77

  Fly    63 WRAEAT--------FSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVE 119
            |:|:.|        .|.......:.|...|..|||.||.|...|.|   ||...          .
 Frog    78 WKADNTDAREAGLAASLSLALNGIFTNTVKLIVGRPRPDFLSRCFP---DGRES----------P 129

  Fly   120 QFHCTNNNLSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHGVWR-----GRGGVRVLRHVLQFL 179
            :||||.:   ...:.|...||||.|:|.:|..:...|||:.|..|     |||  ...|.....:
 Frog   130 EFHCTGD---PELVIEGRKSFPSGHASFAFAGLGFTALYLAGKLRCFSSYGRG--HSWRLCTSLI 189

  Fly   180 LLMAALCVSLSRVADYWHHWSDVLAGALLGVTYA 213
            .|:.|:.::|||..||.|||.||:.||.:|:.:|
 Frog   190 PLLCAIAIALSRTCDYKHHWQDVVVGAFIGLFFA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 53/165 (32%)
plpp5NP_001121478.1 PAP2_containing_1_like 42..230 CDD:239484 64/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.