DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and plppr3

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001120260.1 Gene:plppr3 / 100145312 XenbaseID:XB-GENE-990099 Length:704 Species:Xenopus tropicalis


Alignment Length:316 Identity:81/316 - (25%)
Similarity:134/316 - (42%) Gaps:60/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFFCSDLSIRYPYKDCT-ITVPMLLLMMLLL--PMLFVAVVEIMRICKRFRTR------------ 56
            ||.|.|.::..||.:.. ..:|:|:|:.|..  |...:.|.|.:..|.:.:.:            
 Frog    53 GFQCHDRALSMPYVESNEELIPLLMLLSLAFAAPAASIMVGEGVLYCIQSKLKGRSSSEGSINAG 117

  Fly    57 -----LYFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQP---RLDDGSSCSDLQN 113
                 .:.|...|......||..||.|.|::.:.|.|...|.|...|:|   ||  |:||:    
 Frog   118 GCNFNSFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHAPFFLTVCKPNYTRL--GTSCA---- 176

  Fly   114 AELYVEQFHCTNNN----LSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHGVWRGRGGVRVLRH 174
            :..|:.|..||.|:    ||.|:      :|||.|::||.::.|.:::|.:.:.  ....::|:.
 Frog   177 SNPYITQDICTGNDQHAILSARK------TFPSQHATLSAFAAVYISMYFNSII--SDSTKLLKP 233

  Fly   175 VLQFLLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAY-VGNLLRRQTSSTGRIPPS- 237
            :|.|....||....|:::..|..|..||.:|.|:|...||..|.: ||| ....|..|...||: 
 Frog   234 LLVFSFSFAAGVCGLTQITQYRSHPVDVYSGFLIGAGIAAYLAYHAVGN-FHSSTEETSISPPTK 297

  Fly   238 --LNYSHHLHHQLMADNNNSTASAKVHFLAAAASASMTTTTPLDDIQDSDVEDSRD 291
              |.......|:.:...|.|.::.::              ||....|:|..:..|:
 Frog   298 DPLQALTQRGHESVYHQNKSLSTDEL--------------TPRPRSQESQRQVPRE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 49/161 (30%)
plppr3NP_001120260.1 PAP2_wunen 127..276 CDD:239479 49/162 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.