DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and sgpp1b

DIOPT Version :10

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_001343219.1 Gene:sgpp1b / 100003745 ZFINID:ZDB-GENE-090319-2 Length:437 Species:Danio rerio


Alignment Length:71 Identity:21/71 - (29%)
Similarity:29/71 - (40%) Gaps:10/71 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SFPSAHSSLSFYSMVLLALYVHGVWRGRGGVRVLRHVLQFLLLMAALC--VSLSRVADYWHHWSD 201
            |.||.|:.......:.|.|..:|.|.        ..:|..|.|..:.|  |.|||:....|...|
Zfish   199 SMPSTHAMSGTAIPLSLFLLTYGRWE--------YPMLLGLSLAISWCVLVCLSRIYMGMHSILD 255

  Fly   202 VLAGAL 207
            ::||.|
Zfish   256 IIAGFL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 21/71 (30%)
sgpp1bXP_001343219.1 PAP2_SPPase1 122..270 CDD:239482 21/71 (30%)

Return to query results.
Submit another query.