DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ten-m and C23H4.8

DIOPT Version :9

Sequence 1:	NP_001262211.1	Gene:	Ten-m / 40464	FlyBaseID:	FBgn0004449	Length:	3349	Species:	Drosophila melanogaster
Sequence 2:	NP_001024423.1	Gene:	C23H4.8 / 3565519	WormBaseID:	WBGene00044132	Length:	212	Species:	Caenorhabditis elegans

Alignment Length:	97	Identity:	28/97 - (28%)
Similarity:	41/97 - (42%)	Gaps:	24/97 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly  1078 NGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGEC-ICNPGWKGKECSLRHDECEVADCS 1141
            ||:.:.|.|:|...|.|..|.:.   ..|..:..|.||.| .|..|::|:.|.      |:.
Worm    64 NGKPVDGVCECELDFVGKHCEKK---KNCRTYRRYKNGTCPDCVKGYQGEYCE------EIV--- 116

  Fly  1142 GHGHCVSGK-------CQCMRGYKGKFCEEVD 1166
                |.:||       |||...|.|..|:|::
Worm   117 ----CFNGKPNTHLTECQCEDPYSGAHCDELE 144

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ten-m	NP_001262211.1	TNFRSF	1069..1198	CDD:304602	28/97 (29%)
		CRD2	1106..1151	CDD:276900	13/52 (25%)
		EGF_2	1139..1162	CDD:285248	8/29 (28%)
		Keratin_B2	1162..1330	CDD:279797	2/5 (40%)
		EGF_2	1167..1194	CDD:285248	28/97 (29%)
		DUF3844	1171..>1235	CDD:289707
		EGF_2	<1272..1294	CDD:285248
		NHL	1750..2065	CDD:302697
		NHL repeat	1784..1830	CDD:271320
		NHL repeat	1854..1888	CDD:271320
		NHL repeat	1911..1950	CDD:271320
		NHL repeat	1972..2005	CDD:271320
		NHL repeat	2039..2065	CDD:271320
		RHS_repeat	2183..2218	CDD:283287
		RhsA	2347..3020	CDD:225750
		YD_repeat_2x	2795..2836	CDD:273728
		Rhs_assc_core	2905..2980	CDD:274730
		Tox-GHH	3193..3268	CDD:292269
C23H4.8	NP_001024423.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1225
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810