| Sequence 1: | NP_001262211.1 | Gene: | Ten-m / 40464 | FlyBaseID: | FBgn0004449 | Length: | 3349 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571304.1 | Gene: | wif1 / 30476 | ZFINID: | ZDB-GENE-990712-17 | Length: | 378 | Species: | Danio rerio |
| Alignment Length: | 204 | Identity: | 64/204 - (31%) |
|---|---|---|---|
| Similarity: | 80/204 - (39%) | Gaps: | 53/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1071 CPNGCSGNGQCLLGH-CQCNPGFGGDDCSESVCPVLCSQHGE-YTNGECICNPGWKGKECSLRHD 1133
Fly 1134 ECEVADCS----GHGHCV-SGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCICKKGWKGPD 1193
Fly 1194 CATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRC-EGDACACDPE 1257
Fly 1258 WGGEYCNTR 1266 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ten-m | NP_001262211.1 | TNFRSF | 1069..1198 | CDD:304602 | 41/133 (31%) |
| CRD2 | 1106..1151 | CDD:276900 | 17/50 (34%) | ||
| EGF_2 | 1139..1162 | CDD:285248 | 9/27 (33%) | ||
| Keratin_B2 | 1162..1330 | CDD:279797 | 30/106 (28%) | ||
| EGF_2 | 1167..1194 | CDD:285248 | 5/26 (19%) | ||
| DUF3844 | 1171..>1235 | CDD:289707 | 11/63 (17%) | ||
| EGF_2 | <1272..1294 | CDD:285248 | |||
| NHL | 1750..2065 | CDD:302697 | |||
| NHL repeat | 1784..1830 | CDD:271320 | |||
| NHL repeat | 1854..1888 | CDD:271320 | |||
| NHL repeat | 1911..1950 | CDD:271320 | |||
| NHL repeat | 1972..2005 | CDD:271320 | |||
| NHL repeat | 2039..2065 | CDD:271320 | |||
| RHS_repeat | 2183..2218 | CDD:283287 | |||
| RhsA | 2347..3020 | CDD:225750 | |||
| YD_repeat_2x | 2795..2836 | CDD:273728 | |||
| Rhs_assc_core | 2905..2980 | CDD:274730 | |||
| Tox-GHH | 3193..3268 | CDD:292269 | |||
| wif1 | NP_571304.1 | WIF | 34..177 | CDD:295401 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 343..378 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1225 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||