DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ten-m and F40A3.2

DIOPT Version :9

Sequence 1:	NP_001262211.1	Gene:	Ten-m / 40464	FlyBaseID:	FBgn0004449	Length:	3349	Species:	Drosophila melanogaster
Sequence 2:	NP_505031.1	Gene:	F40A3.2 / 179169	WormBaseID:	WBGene00018217	Length:	230	Species:	Caenorhabditis elegans

Alignment Length:	99	Identity:	32/99 - (32%)
Similarity:	45/99 - (45%)	Gaps:	21/99 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly  1146 CVSG-----KCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCI-CKKGWKGPDCATMDQDALQC 1204
            |::|     :|.|:.|:.|..|..    ...|||.....:|:|| |:.||.|.||..:
Worm    25 CINGTPEGDRCYCIEGWTGTLCHR----KMYCSGFERLQNGSCIECELGWAGTDCDII------- 78

  Fly  1205 LPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCD 1238
              ||.|:|..:.|...|||...:||..|  |:.|
Worm    79 --DCHGNGMPNYDLTECTCTVPYSGKYC--EIAD 108

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ten-m	NP_001262211.1	TNFRSF	1069..1198	CDD:304602	19/57 (33%)
		CRD2	1106..1151	CDD:276900	2/9 (22%)
		EGF_2	1139..1162	CDD:285248	6/20 (30%)
		Keratin_B2	1162..1330	CDD:279797	26/78 (33%)
		EGF_2	1167..1194	CDD:285248	10/27 (37%)
		DUF3844	1171..>1235	CDD:289707	23/64 (36%)
		EGF_2	<1272..1294	CDD:285248
		NHL	1750..2065	CDD:302697
		NHL repeat	1784..1830	CDD:271320
		NHL repeat	1854..1888	CDD:271320
		NHL repeat	1911..1950	CDD:271320
		NHL repeat	1972..2005	CDD:271320
		NHL repeat	2039..2065	CDD:271320
		RHS_repeat	2183..2218	CDD:283287
		RhsA	2347..3020	CDD:225750
		YD_repeat_2x	2795..2836	CDD:273728
		Rhs_assc_core	2905..2980	CDD:274730
		Tox-GHH	3193..3268	CDD:292269
F40A3.2	NP_505031.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1225
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810