DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ten-m and F40A3.2

DIOPT Version :10

Sequence 1:NP_001262211.1 Gene:Ten-m / 40464 FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster
Sequence 2:NP_505031.1 Gene:F40A3.2 / 179169 WormBaseID:WBGene00018217 Length:230 Species:Caenorhabditis elegans


Alignment Length:99 Identity:32/99 - (32%)
Similarity:45/99 - (45%) Gaps:21/99 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1146 CVSG-----KCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCI-CKKGWKGPDCATMDQDALQC 1204
            |::|     :|.|:.|:.|..|..    ...|||.....:|:|| |:.||.|.||..:       
 Worm    25 CINGTPEGDRCYCIEGWTGTLCHR----KMYCSGFERLQNGSCIECELGWAGTDCDII------- 78

  Fly  1205 LPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCD 1238
              ||.|:|..:.|...|||...:||..|  |:.|
 Worm    79 --DCHGNGMPNYDLTECTCTVPYSGKYC--EIAD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ten-mNP_001262211.1 EGF_Tenascin 1071..1098 CDD:480934
EGF_2 1139..1162 CDD:400365 6/20 (30%)
DUF5885 <1181..1229 CDD:437064 17/48 (35%)
EGF_2 1272..1294 CDD:400365
acid_disulf_rpt 1337..1363 CDD:411265
NHL 1750..2065 CDD:302697
NHL repeat 1784..1830 CDD:271323
NHL repeat 1854..1888 CDD:271323
NHL repeat 1911..1950 CDD:271323
NHL repeat 1972..2005 CDD:271323
NHL repeat 2039..2065 CDD:271323
RHS_repeat 2183..2217 CDD:461685
RhsA <2248..2980 CDD:442442
Tox-GHH 3191..3268 CDD:464783
F40A3.2NP_505031.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.