DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srpk79D and LOC110438375

DIOPT Version :9

Sequence 1:NP_001246881.1 Gene:Srpk79D / 40461 FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_021326237.1 Gene:LOC110438375 / 110438375 -ID:- Length:203 Species:Danio rerio


Alignment Length:160 Identity:81/160 - (50%)
Similarity:109/160 - (68%) Gaps:2/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 KDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVF 432
            :.:::||:||||||.||.|||.|||:||..:|:.||.|..::.:|:|::.|.:.||||:|.|:||
Zfish    28 RGKRFVAMKVVKSAQHYTETALDEIKLLRCVRETDPEDPNKDMVVQLIDDFKISGVNGIHVCMVF 92

  Fly   433 EALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMN 497
            |.||..|.|.|:|:|||||.:..|::||||||:|||||||||.||||||||||||:.:|:|....
Zfish    93 EVLGHHLLKWIIKSNYQGLPLPCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAFVRR 157

  Fly   498 QQIDDEINSLRVKGVDFPDSYISSIEKQTK 527
            ..:  |....:..|...|.....|...|.|
Zfish   158 MAV--EATEWQKAGAPPPSGSAVSTAPQLK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 75/135 (56%)
S_TKc 347..>492 CDD:214567 73/123 (59%)
STKc_SRPK <844..1012 CDD:271038
LOC110438375XP_021326237.1 PKc_like 28..>184 CDD:328722 79/157 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290680at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.