DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and HLJ1

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:62/237 - (26%)
Similarity:84/237 - (35%) Gaps:69/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKR 75
            ||......||||.:.:.||..:|||.|||||:|.||||| .:..|.:.||.:|||..:||::.||
Yeast    15 LSKDKHEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKN-SHPKAGEAFKVINRAFEVLSNEEKR 78

  Fly    76 NIYDNYG---------SLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCCCCCCCC 131
            :|||..|         |.|                                           ...
Yeast    79 SIYDRIGRDPDDRQMPSRG-------------------------------------------AAS 100

  Fly   132 NFCCGKFKPPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDLDDVNLGAGGAPVTSQPR 196
            .|.......|:....:.....:|..|.|.|         ||.    |:.|....|||:|..:.|.
Yeast   101 GFRGSAGGSPMGGGFEDMFFNSRFGGQRAG---------PPE----DIFDFLFNAGGSPFGASPF 152

  Fly   197 EQAGGQPVFAMPPPSG-AVGVNPFTGAPVAANENTSLNTTEQ 237
            ..:..  .|:...|.| .|..|...|:|....:..|....:|
Yeast   153 GPSAS--TFSFGGPGGFRVYTNNRGGSPFMRQQPRSRQQQQQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 35/77 (45%)
DnaJ 17..79 CDD:278647 31/61 (51%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 51/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.