DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CWC23

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_011387.2 Gene:CWC23 / 852749 SGDID:S000003096 Length:283 Species:Saccharomyces cerevisiae


Alignment Length:85 Identity:33/85 - (38%)
Similarity:46/85 - (54%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PGMDKRKLSTSGDSLYEILGLP-----KTATGD--DIKKTYRKLALKYHPDKNPDNVDAADKFKE 61
            ||.:...:.....:||::|.||     .|...|  .||:.||.|||||||||:|||.....||..
Yeast     2 PGHELEDVINQRLNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHKFHL 66

  Fly    62 VNRAHSILSDQTKRNIYDNY 81
            ::.|.:||::...|..||.:
Yeast    67 LSTATNILTNADVRPHYDRW 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 29/68 (43%)
CWC23NP_011387.2 DnaJ 15..84 CDD:395170 29/68 (43%)

Return to query results.
Submit another query.