DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and ARL2

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_176206.2 Gene:ARL2 / 842292 AraportID:AT1G59980 Length:414 Species:Arabidopsis thaliana


Alignment Length:78 Identity:39/78 - (50%)
Similarity:51/78 - (65%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            ||:||:|..:|..:||..||::||:||||||||:..||:.||||..|:.:|||...|.:||..||
plant    25 YEVLGIPSNSTDQEIKSAYRRMALRYHPDKNPDDPVAAEMFKEVTFAYEVLSDPENRRLYDTTGS 89

  Fly    84 LGLYIAEQFGEEN 96
                  |..|.||
plant    90 ------EAVGPEN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 35/66 (53%)
DnaJ 17..79 CDD:278647 31/59 (53%)
ARL2NP_176206.2 PRK14295 11..>176 CDD:237665 39/78 (50%)
DnaJ 23..85 CDD:365959 31/59 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.