DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnaja2

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 / 84026 RGDID:71001 Length:412 Species:Rattus norvegicus


Alignment Length:69 Identity:38/69 - (55%)
Similarity:52/69 - (75%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYG 82
            ||:|||:|..|:.:::||.|||||.:|||||||   :|.|||||::.|:.:||:..||.:||.||
  Rat     9 LYDILGVPPGASENELKKAYRKLAKEYHPDKNP---NAGDKFKEISFAYEVLSNPEKRELYDRYG 70

  Fly    83 SLGL 86
            ..||
  Rat    71 EQGL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 36/67 (54%)
DnaJ 17..79 CDD:278647 32/60 (53%)
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 38/69 (55%)
CXXCXGXG motif 143..150
CXXCXGXG motif 159..166
CXXCXGXG motif 186..193
CXXCXGXG motif 202..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.