powered by:
Protein Alignment Csp and Dnaja2
DIOPT Version :9
Sequence 1: | NP_001287144.1 |
Gene: | Csp / 40459 |
FlyBaseID: | FBgn0004179 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_114468.2 |
Gene: | Dnaja2 / 84026 |
RGDID: | 71001 |
Length: | 412 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 38/69 - (55%) |
Similarity: | 52/69 - (75%) |
Gaps: | 3/69 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 LYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYG 82
||:|||:|..|:.:::||.|||||.:||||||| :|.|||||::.|:.:||:..||.:||.||
Rat 9 LYDILGVPPGASENELKKAYRKLAKEYHPDKNP---NAGDKFKEISFAYEVLSNPEKRELYDRYG 70
Fly 83 SLGL 86
..||
Rat 71 EQGL 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.