DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and AT5G05750

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_196194.1 Gene:AT5G05750 / 830459 AraportID:AT5G05750 Length:294 Species:Arabidopsis thaliana


Alignment Length:95 Identity:38/95 - (40%)
Similarity:50/95 - (52%) Gaps:16/95 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAPGMDKRKLST-----------SGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNV 53
            ||.|......||           |....||||||....:.:|::|:||||:||.|||||  |.:.
plant    88 SAAGSSSSSSSTEEQRTIVREIKSKKDYYEILGLKSNCSVEDLRKSYRKLSLKVHPDKNKAPGSE 152

  Fly    54 DAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            :|   ||.|::|...||::..|..||..||
plant   153 EA---FKSVSKAFQCLSNEDTRRKYDGSGS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 28/63 (44%)
AT5G05750NP_196194.1 PRK14298 111..>217 CDD:184612 33/72 (46%)

Return to query results.
Submit another query.