DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and J20

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_193119.1 Gene:J20 / 827017 AraportID:AT4G13830 Length:197 Species:Arabidopsis thaliana


Alignment Length:86 Identity:33/86 - (38%)
Similarity:50/86 - (58%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKN-PDNVDA-ADKFKEVNRAHSILSDQTKRNIYD 79
            |.|::||:.::.|..:||:.|::||.|||||.: ||.|:. .|:|..|..|:..|||..:|.:||
plant    66 SFYDLLGVTESVTLPEIKQAYKQLARKYHPDVSPPDRVEEYTDRFIRVQEAYETLSDPRRRVLYD 130

  Fly    80 NYGSLGLYIAEQFGEENVNAY 100
            ...|:|...:  |.....|.|
plant   131 RDLSMGFSFS--FSGRRQNRY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 29/70 (41%)
DnaJ 17..79 CDD:278647 26/63 (41%)
J20NP_193119.1 DnaJ 66..>143 CDD:223560 31/78 (40%)
DnaJ 66..130 CDD:278647 26/63 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.