DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc12

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001314717.1 Gene:dnajc12 / 797196 ZFINID:ZDB-GENE-070801-3 Length:165 Species:Danio rerio


Alignment Length:101 Identity:34/101 - (33%)
Similarity:54/101 - (53%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDN 80
            :..|.:||..:.:|.:.|...::..||..||||:|:|..|.::|:::..|..:|:|:.||..|| 
Zfish    13 EDYYGLLGCDELSTTEQIVNEFKVKALACHPDKHPENPKAVEQFQKLQEAKEVLTDEKKRKSYD- 76

  Fly    81 YGSLGLYIAEQ----FGEENVNAYFVVTSP--AVKA 110
                 |::..|    |||....:..|.||.  ||||
Zfish    77 -----LWLRSQIKIPFGEWRALSDSVKTSMHWAVKA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 20/61 (33%)
dnajc12NP_001314717.1 DnaJ 14..76 CDD:395170 20/61 (33%)

Return to query results.
Submit another query.