powered by:
Protein Alignment Csp and Dnajc18
DIOPT Version :9
Sequence 1: | NP_001287144.1 |
Gene: | Csp / 40459 |
FlyBaseID: | FBgn0004179 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_083945.1 |
Gene: | Dnajc18 / 76594 |
MGIID: | 1923844 |
Length: | 357 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 31/66 - (46%) |
Similarity: | 44/66 - (66%) |
Gaps: | 5/66 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
|:|||:...|:.:::||.|:|||||:||||| | .|.:.||.:..|.::||:..||..||.|
Mouse 84 YDILGVSHNASDEELKKAYKKLALKFHPDKNCAP---GATEAFKAIGNAFAVLSNPDKRLRYDEY 145
Fly 82 G 82
|
Mouse 146 G 146
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167847136 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.