DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajb2

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:71 Identity:44/71 - (61%)
Similarity:55/71 - (77%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAAD-KFKEVNRAHSILSDQTKRNIYDN 80
            |.||||.:|::|:.|||||.|||.||::||||||||.:.|: |||||..|:.:|||:.||.|||.
  Rat     3 SYYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDR 67

  Fly    81 YGSLGL 86
            ||..||
  Rat    68 YGREGL 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 42/69 (61%)
DnaJ 17..79 CDD:278647 38/62 (61%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 44/71 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.