powered by:
Protein Alignment Csp and Dnajb8
DIOPT Version :9
Sequence 1: | NP_001287144.1 |
Gene: | Csp / 40459 |
FlyBaseID: | FBgn0004179 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_064348.1 |
Gene: | Dnajb8 / 56691 |
MGIID: | 1922801 |
Length: | 227 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 37/65 - (56%) |
Similarity: | 52/65 - (80%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAAD-KFKEVNRAHSILSDQTKRNIYDNYG 82
||:||:..:|:.:||||.||||||::||||||||.:.|: |||:|:.|:.:|||..||::||..|
Mouse 5 YEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDRAG 69
Fly 83 82
Mouse 70 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.