powered by:
Protein Alignment Csp and DNAJC12
DIOPT Version :9
Sequence 1: | NP_001287144.1 |
Gene: | Csp / 40459 |
FlyBaseID: | FBgn0004179 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_068572.1 |
Gene: | DNAJC12 / 56521 |
HGNCID: | 28908 |
Length: | 198 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 21/70 - (30%) |
Similarity: | 42/70 - (60%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 STSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRN 76
|...:..|.:||..:.::.:.|...::..||:.||||:|:|..|.:.|:::.:|..||:::..|.
Human 9 SEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRA 73
Fly 77 IYDNY 81
.||::
Human 74 RYDHW 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165156748 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.