DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJC12

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_068572.1 Gene:DNAJC12 / 56521 HGNCID:28908 Length:198 Species:Homo sapiens


Alignment Length:70 Identity:21/70 - (30%)
Similarity:42/70 - (60%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRN 76
            |...:..|.:||..:.::.:.|...::..||:.||||:|:|..|.:.|:::.:|..||:::..|.
Human     9 SEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRA 73

  Fly    77 IYDNY 81
            .||::
Human    74 RYDHW 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 20/65 (31%)
DnaJ 17..79 CDD:278647 18/61 (30%)
DNAJC12NP_068572.1 CbpA 9..>164 CDD:225124 21/70 (30%)
DnaJ 14..76 CDD:306689 18/61 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.