DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc10

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001077016.1 Gene:dnajc10 / 557858 ZFINID:ZDB-GENE-070327-1 Length:791 Species:Danio rerio


Alignment Length:89 Identity:38/89 - (42%)
Similarity:58/89 - (65%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNI 77
            :|.:..|::||:.:.|:..||::.::||||..||||||::..|.|||.::|||:.:|.|:..|..
Zfish    29 SSDEDYYKLLGISREASTRDIRQAFKKLALTMHPDKNPNDETAHDKFLKINRAYEVLKDEDLRKK 93

  Fly    78 YDNYGSLGLYIAEQFGE-ENVNAY 100
            ||.||..||...:|.|. |:.|.|
Zfish    94 YDKYGEKGLQDEQQGGRYESWNYY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 30/68 (44%)
DnaJ 17..79 CDD:278647 26/61 (43%)
dnajc10NP_001077016.1 DnaJ 33..>129 CDD:223560 37/85 (44%)
DnaJ 33..95 CDD:278647 26/61 (43%)
PDI_a_ERdj5_N 128..228 CDD:239301
ER_PDI_fam 129..648 CDD:273457
Thioredoxin_like <276..318 CDD:294274
PDI_a_family 348..443 CDD:239259
PDI_a_ERdj5_C 450..546 CDD:239302
PDI_a_ERdj5_C 552..660 CDD:239302
PDI_a_ERdj5_C 666..772 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.