DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJA4

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_061072.3 Gene:DNAJA4 / 55466 HGNCID:14885 Length:426 Species:Homo sapiens


Alignment Length:241 Identity:66/241 - (27%)
Similarity:94/241 - (39%) Gaps:88/241 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDN--- 80
            |:|||:..:|:.::|||.|||||||||||||||.   .:|||.:::|:.:|||..||::||.   
Human    37 YDILGVKPSASPEEIKKAYRKLALKYHPDKNPDE---GEKFKLISQAYEVLSDPKKRDVYDQGGE 98

  Fly    81 -----------------------YGSLGLYIAEQFGEENV--------NAYFVVTSP-AVKAVVI 113
                                   :|..|....|:.|:..|        :.|..||.. |::..||
Human    99 QAIKEGGSGSPSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVI 163

  Fly   114 C--CAVITG-------CCCC---------------------CCCCCC------------CNFCCG 136
            |  |..:.|       |..|                     ..|..|            |..|.|
Human   164 CEKCEGVGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSG 228

  Fly   137 KFKPPVNESHDQYSHLNRPDGNREGNDMPTHLG---QPPRLEDVDL 179
              ...:.|......|:.:  |.::|..:..| |   |.|.||..|:
Human   229 --AKVIREKKIIEVHVEK--GMKDGQKILFH-GEGDQEPELEPGDV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 35/92 (38%)
DnaJ 17..79 CDD:278647 32/59 (54%)
DNAJA4NP_061072.3 PTZ00037 15..423 CDD:240236 66/241 (27%)
DnaJ 36..94 CDD:278647 32/59 (54%)
DnaJ_C 135..361 CDD:199909 28/140 (20%)
DnaJ_zf 164..230 CDD:199908 10/67 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.