Sequence 1: | NP_001287144.1 | Gene: | Csp / 40459 | FlyBaseID: | FBgn0004179 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061072.3 | Gene: | DNAJA4 / 55466 | HGNCID: | 14885 | Length: | 426 | Species: | Homo sapiens |
Alignment Length: | 241 | Identity: | 66/241 - (27%) |
---|---|---|---|
Similarity: | 94/241 - (39%) | Gaps: | 88/241 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDN--- 80
Fly 81 -----------------------YGSLGLYIAEQFGEENV--------NAYFVVTSP-AVKAVVI 113
Fly 114 C--CAVITG-------CCCC---------------------CCCCCC------------CNFCCG 136
Fly 137 KFKPPVNESHDQYSHLNRPDGNREGNDMPTHLG---QPPRLEDVDL 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Csp | NP_001287144.1 | DnaJ | 17..>86 | CDD:223560 | 35/92 (38%) |
DnaJ | 17..79 | CDD:278647 | 32/59 (54%) | ||
DNAJA4 | NP_061072.3 | PTZ00037 | 15..423 | CDD:240236 | 66/241 (27%) |
DnaJ | 36..94 | CDD:278647 | 32/59 (54%) | ||
DnaJ_C | 135..361 | CDD:199909 | 28/140 (20%) | ||
DnaJ_zf | 164..230 | CDD:199908 | 10/67 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |