DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJB12

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens


Alignment Length:66 Identity:32/66 - (48%)
Similarity:46/66 - (69%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            |||||:.:.|:.:|:||.||:||||:|||||  |   .|.:.||.:..|:::||:..||..||.:
Human   112 YEILGVSRGASDEDLKKAYRRLALKFHPDKNHAP---GATEAFKAIGTAYAVLSNPEKRKQYDQF 173

  Fly    82 G 82
            |
Human   174 G 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 29/61 (48%)
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ_bact 110..>236 CDD:274090 32/66 (48%)
DUF1977 268..366 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.