powered by:
Protein Alignment Csp and Dnajb8
DIOPT Version :9
Sequence 1: | NP_001287144.1 |
Gene: | Csp / 40459 |
FlyBaseID: | FBgn0004179 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102718.1 |
Gene: | Dnajb8 / 500253 |
RGDID: | 1561981 |
Length: | 230 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 38/68 - (55%) |
Similarity: | 53/68 - (77%) |
Gaps: | 1/68 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAAD-KFKEVNRAHSILSDQTKRNIYDNYG 82
||:||:..:|:.:||||.||||||::||||||||.:.|: |||:|:.|:.:|||..||::||..|
Rat 5 YEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDRAG 69
Fly 83 SLG 85
..|
Rat 70 CDG 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.