DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajc5b

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001102650.1 Gene:Dnajc5b / 499579 RGDID:1562486 Length:199 Species:Rattus norvegicus


Alignment Length:146 Identity:87/146 - (59%)
Similarity:114/146 - (78%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PGMDKRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSI 68
            |...:|.:||||:||||||||.|.|:.::||||||||||::|||||||:..||:||||:|.||:|
  Rat     6 PNQRQRAMSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTI 70

  Fly    69 LSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCCCCCCCCNF 133
            |:|.:||||||.|||||||:|||||:||||.||:::|...|.:.|...::|||..|||.|||||.
  Rat    71 LTDNSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLLTGCYFCCCLCCCCNC 135

  Fly   134 CCGKFKPPVNESHDQY 149
            |||..:|..:...:::
  Rat   136 CCGHCRPKTSTPEEEF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 49/68 (72%)
DnaJ 17..79 CDD:278647 43/61 (70%)
Dnajc5bNP_001102650.1 DnaJ 19..>88 CDD:223560 49/68 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350666
Domainoid 1 1.000 102 1.000 Domainoid score I6694
eggNOG 1 0.900 - - E2759_KOG0716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3504
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1401920at2759
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 1 1.000 - - otm45426
orthoMCL 1 0.900 - - OOG6_105499
Panther 1 1.100 - - O PTHR44027
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X732
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.