DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnaja1

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001011012.1 Gene:dnaja1 / 496421 XenbaseID:XB-GENE-976936 Length:400 Species:Xenopus tropicalis


Alignment Length:64 Identity:34/64 - (53%)
Similarity:49/64 - (76%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYG 82
            |:|||:...:|.|::||.||||||||||||||:.   .:|||::::|:.:|||..||::||..|
 Frog     8 YDILGVKPNSTPDELKKAYRKLALKYHPDKNPNE---GEKFKQISQAYEVLSDSKKRDLYDKGG 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 31/59 (53%)
dnaja1NP_001011012.1 PTZ00037 7..397 CDD:240236 34/64 (53%)

Return to query results.
Submit another query.