DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc4

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001007515.1 Gene:dnajc4 / 493241 XenbaseID:XB-GENE-994193 Length:233 Species:Xenopus tropicalis


Alignment Length:97 Identity:29/97 - (29%)
Similarity:49/97 - (50%) Gaps:12/97 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            |::||:.:.||.::||..:..::.|.|||.:|.|.....:|..::.|:.:||..|.|..||.   
 Frog    34 YQLLGIERKATSEEIKNAFFTMSKKLHPDSDPTNPLLHSQFVRLSEAYKVLSRDTSRREYDQ--- 95

  Fly    84 LGLYIAEQ-----FGEENVNAYFVVTSPAVKA 110
              |..|.|     :|..  ::|:...||:..|
 Frog    96 --LLDAAQRDRWAYGAR--SSYYQGPSPSAAA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 19/59 (32%)
dnajc4NP_001007515.1 DnaJ 32..161 CDD:440252 29/97 (30%)

Return to query results.
Submit another query.