DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and LOC4577058

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_001238449.3 Gene:LOC4577058 / 4577058 VectorBaseID:AGAMI1_000028 Length:385 Species:Anopheles gambiae


Alignment Length:69 Identity:31/69 - (44%)
Similarity:42/69 - (60%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            ||:||:.:.||..:|||.|:|.||:.|||||  |..::|   ||.:..|...|:|..||..||.|
Mosquito   116 YEVLGVTQEATDSEIKKCYKKHALQLHPDKNKAPGAMEA---FKSLGNAVETLTDPQKRKAYDLY 177

  Fly    82 GSLG 85
            .:.|
Mosquito   178 RTTG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 27/61 (44%)
LOC4577058XP_001238449.3 None

Return to query results.
Submit another query.