DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc5g

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001005622.1 Gene:dnajc5g / 448068 XenbaseID:XB-GENE-5761475 Length:185 Species:Xenopus tropicalis


Alignment Length:209 Identity:104/209 - (49%)
Similarity:133/209 - (63%) Gaps:28/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPGMDKRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRA 65
            |:.||..:||:|.||.|||.:|||.|.|:.|:|||.||||||:|||||||||.:||:||||:|.|
 Frog     1 MAEPGRPQRKMSRSGISLYAVLGLQKGASPDEIKKAYRKLALRYHPDKNPDNPEAAEKFKEINNA 65

  Fly    66 HSILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCCCCCCC 130
            ||.|||:.||.:||.|||:|||:|||||:|:|..||:::....||:::||...:    |||||||
 Frog    66 HSTLSDENKRKMYDEYGSMGLYVAEQFGDESVKYYFLMSKCWFKALLVCCFFSS----CCCCCCC 126

  Fly   131 CNFCCGKFKPPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDLDDVNLGAGGAPVTSQP 195
            |.||||:.|||  |..|.|..:|           |..|....|.||        |:||.|:..||
 Frog   127 CLFCCGRCKPP--EEDDSYKSVN-----------PEDLEAQIRAED--------GSGGDPIRVQP 170

  Fly   196 REQAGGQPVFAMPP 209
               :...|:...||
 Frog   171 ---SAAPPIHPEPP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 47/68 (69%)
DnaJ 17..79 CDD:278647 42/61 (69%)
dnajc5gNP_001005622.1 DnaJ 17..>86 CDD:223560 47/68 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7354
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1401920at2759
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X732
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.