DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajb1a

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001003571.1 Gene:dnajb1a / 445177 ZFINID:ZDB-GENE-040801-90 Length:335 Species:Danio rerio


Alignment Length:72 Identity:38/72 - (52%)
Similarity:50/72 - (69%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYD 79
            |...|.|||:.|.|:.::|||.|||.||::||||| .:..|.|||||:..|:.:|||..|::|||
Zfish     2 GKDYYRILGIEKGASDEEIKKAYRKQALRFHPDKN-KSAGAEDKFKEIAEAYDVLSDAKKKDIYD 65

  Fly    80 NYGSLGL 86
            .||..||
Zfish    66 RYGEDGL 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 35/68 (51%)
DnaJ 17..79 CDD:278647 31/61 (51%)
dnajb1aNP_001003571.1 DnaJ 1..335 CDD:223560 38/72 (53%)
DnaJ 4..65 CDD:278647 31/61 (51%)
DnaJ_C 157..321 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.