DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG17187

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster


Alignment Length:63 Identity:29/63 - (46%)
Similarity:46/63 - (73%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYD 79
            :||::||:...:..::|:|.|||.||:.||||||||..|.::|.|:::|..||:|::.|..||
  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 27/61 (44%)
CG17187NP_650056.1 DnaJ 10..72 CDD:395170 27/61 (44%)
RRM_DNAJC17 175..247 CDD:409863
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.