DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG6693

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001262473.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster


Alignment Length:101 Identity:29/101 - (28%)
Similarity:52/101 - (51%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYEILGLPKTATGDDIKKTYRKLALKYHPDKNPD--NVDAADKFKEVNRAHSILSDQTKRNIYDN 80
            :|:::.|.:.|...::||.|.||:|..|||:.|:  ..::.:|||.:::.:.:|:|..||.:||.
  Fly    16 VYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALYDE 80

  Fly    81 YG----------------SLGLYIAEQFGEENVNAY 100
            .|                .|...|.:...||::|.|
  Fly    81 QGVIDDDDESESKLSSWLELWSKIFKPITEEDINNY 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 24/85 (28%)
DnaJ 17..79 CDD:278647 20/62 (32%)
CG6693NP_001262473.1 DnaJ 15..79 CDD:278647 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.