DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG10565

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649284.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster


Alignment Length:108 Identity:29/108 - (26%)
Similarity:47/108 - (43%) Gaps:30/108 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APGMDKR-----KLSTSGDSL------------------YEILGLPK---TATGDDIKKTYRKLA 41
            |||..:|     ||...|:.:                  |.:|||.|   .|:.||:::.||::.
  Fly    39 APGGVERSESDEKLEGVGEEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMV 103

  Fly    42 LKYHPD----KNPDNVDAADKFKEVNRAHSILSDQTKRNIYDN 80
            |.:|||    |..:.:...|.|..:.:|:.||.....|..:|:
  Fly   104 LLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 21/86 (24%)
CG10565NP_649284.1 ZUO1 56..354 CDD:227594 23/91 (25%)
RAC_head 328..407 CDD:435537
SANT 585..632 CDD:238096
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.