DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG7387

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster


Alignment Length:107 Identity:32/107 - (29%)
Similarity:53/107 - (49%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GMDKRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSIL 69
            ||.|       |..|::||:.:.||...|:..:..||.:|||| :..:......|:|::.|::||
  Fly    95 GMPK-------DYYYKVLGVNRHATIQQIRSAFYALAKRYHPD-STHSEQKLKHFQELSNAYNIL 151

  Fly    70 SDQTKRNIYDNYG----------------SLGLYIAEQFGEE 95
            :|:|||..||..|                ::||..|::|..:
  Fly   152 TDETKRLEYDQLGGIKDERAFLEQAGNPLNVGLEEAKKFDSD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 24/84 (29%)
DnaJ 17..79 CDD:278647 21/61 (34%)
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 28/94 (30%)
DnaJ 101..161 CDD:278647 21/60 (35%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.