DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc5aa

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001002464.1 Gene:dnajc5aa / 386768 ZFINID:ZDB-GENE-031113-20 Length:202 Species:Danio rerio


Alignment Length:239 Identity:121/239 - (50%)
Similarity:141/239 - (58%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQ 72
            :|.|||||:|||.:||:.|.||.|||||:||||||||||||||||.:|||||||:|.||:||:|.
Zfish     7 QRSLSTSGESLYHVLGVDKVATVDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILNDP 71

  Fly    73 TKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCCCCCCCCNFCCGK 137
            |||||||.|||||||:||||||||||.|||::|...||:.|.|.:.|||..|||.|||||.||||
Zfish    72 TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFIFCGLATGCYFCCCLCCCCNCCCGK 136

  Fly   138 FK--PPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDLDDVNLGAGGAPVTSQPREQAG 200
            .|  ||           :|||        |.....|..||             |.:.|..||..|
Zfish   137 CKPRPP-----------DRPD--------PEFYVSPEDLE-------------AQLQSDERETVG 169

  Fly   201 GQPVFAMPPPSGAVGVNPFTGAPVAANENTSLNTT-EQTTYTPD 243
            |:|:...|.               :|.|.|.|.:. ..|||..|
Zfish   170 GEPIVLQPS---------------SATETTQLTSDGYHTTYHTD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 53/68 (78%)
DnaJ 17..79 CDD:278647 47/61 (77%)
dnajc5aaNP_001002464.1 DnaJ 16..>85 CDD:223560 53/68 (78%)
DnaJ 16..78 CDD:278647 47/61 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6646
eggNOG 1 0.900 - - E2759_KOG0716
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9631
Inparanoid 1 1.050 217 1.000 Inparanoid score I3575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1401920at2759
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 1 1.000 - - otm25287
orthoMCL 1 0.900 - - OOG6_105499
Panther 1 1.100 - - O PTHR44027
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3080
SonicParanoid 1 1.000 - - X732
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.