DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajc5g

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_017449734.1 Gene:Dnajc5g / 366567 RGDID:1307426 Length:186 Species:Rattus norvegicus


Alignment Length:141 Identity:76/141 - (53%)
Similarity:99/141 - (70%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQT 73
            ::||..|.|||.:|.|.|.|..::|||.||||||:|||||||.|..||:.||::|.||::|:|.|
  Rat     9 QRLSKDGKSLYAVLELKKGAQPEEIKKAYRKLALQYHPDKNPGNSQAAEFFKDINAAHAVLTDPT 73

  Fly    74 KRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCCCCCCCCNFCCGKF 138
            |:.|||.:||||||:.:.||||.|..||:|.|...|.:||.|.::||||||||||    .|||:.
  Rat    74 KKKIYDRHGSLGLYLYDHFGEEGVRTYFIVNSCWFKTLVILCCLLTGCCCCCCCC----LCCGRL 134

  Fly   139 KPPVNESHDQY 149
            .|...|.::.|
  Rat   135 NPSAEEENENY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 41/68 (60%)
DnaJ 17..79 CDD:278647 36/61 (59%)
Dnajc5gXP_017449734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350668
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1401920at2759
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44027
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X732
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.