DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG8531

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:74 Identity:30/74 - (40%)
Similarity:43/74 - (58%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSLYEILGLPKTATGDDIKKTYRKLALKYHPDK--NPDNVDAAD-KFKEVNRAHSILSDQTKRNI 77
            ::.|..|.||:.||.:.|...|||.:..:||||  :||:...|: .|....||:.:|||..:|.|
  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAI 78

  Fly    78 YDNYGSLGL 86
            ||:.|..||
  Fly    79 YDSVGEKGL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 25/64 (39%)
CG8531NP_610945.1 DnaJ 15..>123 CDD:440252 30/73 (41%)
DnaJ-like_C11_C 400..538 CDD:463378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.