DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG8531

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:74 Identity:30/74 - (40%)
Similarity:43/74 - (58%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSLYEILGLPKTATGDDIKKTYRKLALKYHPDK--NPDNVDAAD-KFKEVNRAHSILSDQTKRNI 77
            ::.|..|.||:.||.:.|...|||.:..:||||  :||:...|: .|....||:.:|||..:|.|
  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAI 78

  Fly    78 YDNYGSLGL 86
            ||:.|..||
  Fly    79 YDSVGEKGL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 28/71 (39%)
DnaJ 17..79 CDD:278647 25/64 (39%)
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 30/73 (41%)
DnaJ 15..80 CDD:278647 25/64 (39%)
DUF3395 409..538 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.