DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajc16

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001014216.1 Gene:Dnajc16 / 362652 RGDID:1359395 Length:771 Species:Rattus norvegicus


Alignment Length:112 Identity:42/112 - (37%)
Similarity:61/112 - (54%) Gaps:22/112 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MDKRKLSTSGDSL-----------------YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNV 53
            |:.::||.|...|                 |.:||:.:||:..||||.|:|||.::|||||.| .
  Rat     1 MELKRLSISWQFLIVLVLILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKD-P 64

  Fly    54 DAADKFKEVNRAHSILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAY 100
            .|.|||.::::|:.|||::.||..||:||..|    |..|.:....|
  Rat    65 GAEDKFIQISKAYEILSNEEKRTNYDHYGDAG----ENQGYQQQREY 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 34/85 (40%)
DnaJ 17..79 CDD:278647 30/78 (38%)
Dnajc16NP_001014216.1 DnaJ 29..90 CDD:278647 29/61 (48%)
TRX_DnaJ 133..242 CDD:239261
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.