DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajb11

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001015021.1 Gene:Dnajb11 / 360734 RGDID:1307373 Length:358 Species:Rattus norvegicus


Alignment Length:88 Identity:40/88 - (45%)
Similarity:59/88 - (67%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIY 78
            :|...|:|||:|::|:..||||.||||||:.|||:|||:..|.:||:::..|:.:|||..||..|
  Rat    22 AGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQY 86

  Fly    79 DNYGSLGLYIAEQFGEENVNAYF 101
            |.||..||....|....::.::|
  Rat    87 DTYGEEGLKDGHQSSHGDIFSHF 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 31/61 (51%)
Dnajb11NP_001015021.1 DnaJ_bact 25..345 CDD:274090 39/85 (46%)

Return to query results.
Submit another query.