DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Rme-8

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster


Alignment Length:81 Identity:29/81 - (35%)
Similarity:46/81 - (56%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MDKRKLSTSGDSLYEILG--LPKTATGDD--IKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAH 66
            ::|:....:....|:.||  |.||...|:  |:|:|.|||..|||||||   :..:.|::||:|:
  Fly  1291 VEKKPPQMTIQQAYQDLGIDLTKTPKPDESMIRKSYYKLAQMYHPDKNP---NGREIFEKVNQAY 1352

  Fly    67 SILSDQTKRNIYDNYG 82
            ..|   ..||::.:.|
  Fly  1353 EFL---CSRNVWSSGG 1365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 27/65 (42%)
Rme-8NP_610467.1 RME-8_N 12..835 CDD:466078
GYF_2 972..1026 CDD:464112
DnaJ 1304..1356 CDD:395170 25/57 (44%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.