DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnj-19

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_504452.1 Gene:dnj-19 / 3565862 WormBaseID:WBGene00001037 Length:439 Species:Caenorhabditis elegans


Alignment Length:70 Identity:34/70 - (48%)
Similarity:46/70 - (65%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            :||..|.:...|:..||||:|.|||.:||||||||:   .|||||::.|:.:||...||.:||..
 Worm    13 TLYTTLNVRPDASQADIKKSYFKLAKEYHPDKNPDH---GDKFKEISFAYEVLSSPEKRRLYDAR 74

  Fly    82 GSLGL 86
            |..|:
 Worm    75 GLEGV 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 30/61 (49%)
dnj-19NP_504452.1 PTZ00037 1..439 CDD:240236 34/70 (49%)

Return to query results.
Submit another query.