DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnj-19

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_504452.1 Gene:dnj-19 / 3565862 WormBaseID:WBGene00001037 Length:439 Species:Caenorhabditis elegans


Alignment Length:70 Identity:34/70 - (48%)
Similarity:46/70 - (65%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            :||..|.:...|:..||||:|.|||.:||||||||:   .|||||::.|:.:||...||.:||..
 Worm    13 TLYTTLNVRPDASQADIKKSYFKLAKEYHPDKNPDH---GDKFKEISFAYEVLSSPEKRRLYDAR 74

  Fly    82 GSLGL 86
            |..|:
 Worm    75 GLEGV 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 33/68 (49%)
DnaJ 17..79 CDD:278647 30/61 (49%)
dnj-19NP_504452.1 PTZ00037 1..439 CDD:240236 34/70 (49%)
DnaJ 13..72 CDD:278647 30/61 (49%)
DnaJ_zf 169..235 CDD:199908
DnaJ_C 234..367 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.