DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG5001

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608586.2 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster


Alignment Length:72 Identity:46/72 - (63%)
Similarity:55/72 - (76%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYD 79
            |...|:|||||||||.|:|||.||||||:|||||| ...:|.||||||..|:.:|||::||.:||
  Fly     2 GKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKN-KAANAEDKFKEVAEAYEVLSDKSKREVYD 65

  Fly    80 NYGSLGL 86
            .||..||
  Fly    66 KYGEDGL 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 39/61 (64%)
CG5001NP_608586.2 DnaJ_bact 4..347 CDD:274090 45/70 (64%)

Return to query results.
Submit another query.