DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and shv

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:71 Identity:31/71 - (43%)
Similarity:47/71 - (66%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRN 76
            |.:|...|:||.:.|.|..:::||.||:||.:.|||||.|:.||:.||:::..|:.:||:..||.
  Fly    20 SFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRK 84

  Fly    77 IYDNYG 82
            .||..|
  Fly    85 TYDRCG 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 26/61 (43%)
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 29/66 (44%)

Return to query results.
Submit another query.