powered by:
Protein Alignment Csp and dnajb1b
DIOPT Version :9
Sequence 1: | NP_001287144.1 |
Gene: | Csp / 40459 |
FlyBaseID: | FBgn0004179 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956067.1 |
Gene: | dnajb1b / 327244 |
ZFINID: | ZDB-GENE-030131-5455 |
Length: | 337 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 38/72 - (52%) |
Similarity: | 50/72 - (69%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 GDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYD 79
|...|.:||:.|.|:.|:|||.|||.||||||||| .:..|.:||||:..|:.:|||..|::|||
Zfish 2 GKDYYSVLGIQKGASDDEIKKAYRKQALKYHPDKN-KSAGAEEKFKEIAEAYDVLSDPKKKDIYD 65
Fly 80 NYGSLGL 86
.:|..||
Zfish 66 RFGEEGL 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.