DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnaja2b

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_997830.1 Gene:dnaja2b / 324164 ZFINID:ZDB-GENE-030131-2884 Length:413 Species:Danio rerio


Alignment Length:69 Identity:34/69 - (49%)
Similarity:53/69 - (76%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYG 82
            ||::||:..:|:.:::||.|||||.:|||||||   :|.|||||::.|:.:|::..|:::||.||
Zfish     9 LYDLLGVSPSASENELKKAYRKLAKEYHPDKNP---NAGDKFKEISFAYEVLTNPEKKDLYDRYG 70

  Fly    83 SLGL 86
            ..||
Zfish    71 EQGL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 32/67 (48%)
DnaJ 17..79 CDD:278647 28/60 (47%)
dnaja2bNP_997830.1 PTZ00037 4..413 CDD:240236 34/69 (49%)
DnaJ 9..67 CDD:278647 28/60 (47%)
DnaJ_C 116..342 CDD:199909
DnaJ_zf 145..211 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.