DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnaja1

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_955956.1 Gene:dnaja1 / 323922 ZFINID:ZDB-GENE-030131-2642 Length:398 Species:Danio rerio


Alignment Length:64 Identity:32/64 - (50%)
Similarity:48/64 - (75%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYG 82
            |::||:..:|:.:::||.||||||||||||||..   .:|||::::|:.:|||..||.:||..|
Zfish     8 YDMLGVKPSASPEELKKAYRKLALKYHPDKNPTE---GEKFKQISQAYEVLSDAKKREVYDRGG 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 29/59 (49%)
dnaja1NP_955956.1 PTZ00037 2..395 CDD:240236 32/64 (50%)

Return to query results.
Submit another query.