DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc5ga

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_955917.1 Gene:dnajc5ga / 322863 ZFINID:ZDB-GENE-030131-1583 Length:199 Species:Danio rerio


Alignment Length:221 Identity:108/221 - (48%)
Similarity:137/221 - (61%) Gaps:50/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PGMDK--RKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAH 66
            |..|:  ||:||:|||||::|||.|.||.:|||:.||||||||||||||||.:||:||||:|.|:
Zfish     6 PPSDRPQRKMSTTGDSLYKVLGLEKGATAEDIKRAYRKLALKYHPDKNPDNPEAAEKFKEINNAN 70

  Fly    67 SILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCCCCCCCC 131
            |||:|:|||.|||.|||:|||::||||||:|..||:::....||.|:||||.:   |||||||||
Zfish    71 SILTDETKRKIYDEYGSMGLYVSEQFGEESVKYYFLMSKWWFKATVMCCAVFS---CCCCCCCCC 132

  Fly   132 NFCCGKFKPPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDLDDVNL------GAGGAP 190
             |||||.|||..:.:.||                           ||.:|:..      ..|||.
Zfish   133 -FCCGKCKPPEEDENYQY---------------------------VDPEDLEAQIKAEQDGGGAD 169

  Fly   191 V-----------TSQPREQAGGQPVF 205
            |           ||:.:..|..|||:
Zfish   170 VPILIQPSSTANTSESKHFAASQPVY 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 49/68 (72%)
DnaJ 17..79 CDD:278647 44/61 (72%)
dnajc5gaNP_955917.1 DnaJ 21..>90 CDD:223560 49/68 (72%)
DnaJ 21..83 CDD:278647 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1401920at2759
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 1 1.000 - - otm25287
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44027
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3080
SonicParanoid 1 1.000 - - X732
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.