DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc3a

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_955904.2 Gene:dnajc3a / 322544 ZFINID:ZDB-GENE-030131-1264 Length:504 Species:Danio rerio


Alignment Length:64 Identity:25/64 - (39%)
Similarity:39/64 - (60%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVD---AADKFKEVNRAHSILSDQTKRNIYD 79
            |:|||:.:||...:|.|.|||||.::|||...|..:   |..||.::.:|..:|:|...|:.:|
Zfish   396 YKILGVKRTAQKKEILKAYRKLAQQWHPDNFQDAEEKKKAEKKFIDIAQAKEVLTDPEMRSKFD 459

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 25/64 (39%)
DnaJ 17..79 CDD:278647 24/62 (39%)
dnajc3aNP_955904.2 TPR repeat 37..65 CDD:276809
TPR_11 38..102 CDD:290150
TPR repeat 70..100 CDD:276809
TPR_11 73..136 CDD:290150
TPR_1 73..104 CDD:278916
TPR repeat 105..133 CDD:276809
TPR repeat 157..182 CDD:276809
TPR_11 194..252 CDD:290150
TPR repeat 221..251 CDD:276809
TPR repeat 256..281 CDD:276809
LcrH_SycD 262..389 CDD:274197
TPR repeat 301..335 CDD:276809
TPR repeat 340..368 CDD:276809